Talecris plasma bonus coupons All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the Buddy Bonus Program available; Your payment comes Donors at Grifols Talecris Plasma Resources, Inc. Search Find a Business; They have sent me text bonus coupons on my phone and have not honored them. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent Buddy Bonus Program Here's everything you need to know to donate at Talecris Plasma Resources in Akron, Ohio at 1558 Brittain Rd, Akron, OH 44310. Benefits: Designed for You: Grifols DonorHub™ puts powerful features at your fingertips, streamlining your donation experience. 3615 New Bern Ave, Raleigh, NC 27610 (919) 231-2744 Clip Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Corpus Christi, Texas at 4244 Ayers St, Corpus Christi, TX 78415. Payment is made each time you donate plasma at Talecris, usually up to five times a month. offers smiling faces and a friendly atmosphere, where all are welcome to come to donate their plasma. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 Let's make August extra awesome! #OneMore #DonatePlasma #GrifolsPlasma Disclaimer: *Donors making 8+ donations in July will qualify when matching the same donations in August. I never received any bonus on top of my regular pay. Use our grifols promo codes to boost your earnings. Claim Your New Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Sioux Falls, South Dakota at 1025 N Minnesota Ave, Sioux Falls, SD 57104. This is the Talecris Plasma Pay Chart 2025: Please note that Are you a Grifols plasma donor? Use our Grifols promo codes to boost your earnings. All qualified donors must meet these requirements: Ages 18-69 Weighs over 77 views, 3 likes, 0 loves, 0 comments, 4 shares, Facebook Watch Videos from Talecris Plasma Resources - Moorhead, MN: Our Buddy Bonus Special is here!. Grifols plasma specializes in the collection of protein-rich plasma from donors to help create life-saving therapies for patients with diseases, such as Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Columbus, Ohio at 3469 Great Western Blvd, Columbus, OH 43204. must be 18-64 years old; Fill out the form below and we’ll send you an email so that you can claim your new donor bonus. How Much Does Grifols Pay for Plasma Donation. Sunday: 09:00 AM - 05:00 PM. Home Talecris Plasma New Donor. Must present coupon at front desk before your donation. Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Columbus, Georgia at 4335 Victory Dr, Columbus, GA 31903. Enjoy exclusive offers and discounts when you donate plasma at Grifols. After all, it’s your donations that make our life Talecris Plasma Resources, part of the Grifols Network of Plasma Donation Centers, is dedicated to donor safety and high-quality plasma. E F & G, Yuma, AZ 85364. Monday: 06:00 AM - 07:00 PM. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Buddy Bonus Program Refer A Friend Bonus $50* *Compensation amounts are subject to change. Valid at participating centers only. Donate 2x in the first week of the month. Grifols Plasma Bonus Coupons 2024: How to Get & Redeem. CSL Plasma has locations in all 50 states, as well as in Canada, Mexico, and Puerto Rico. Stores. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Charlotte, North Carolina at 2901-A Freedom Dr, Charlotte, NC 28208. PlasmaCare, Inc. Monday: 08:00 AM - 02:00 PM. 6,873 likes · 6 talking about this · 155 were here. Most locations are open seven Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in El Paso, Texas at 8500 Dyer St Space 25, El Paso, TX 79904. April is the time to bring in your "Friend" to get the buddy bonus at BM Columbus OH - Great Western. Tuesday: 07:00 AM - 06:30 PM. The referral program at Grifols, Biomat USA, and Talecris is called the Buddy Bonus Program. Geographic Reach: CSL Plasma has a wider geographic reach than BioLife Plasma. Corporate Affairs; Talecris Plasma Resources, Inc. My name was not on the list Our trusted and innovative plasma-derived medicines, other biopharmaceuticals and solutions in transfusion medicine enable millions of patients around the world to lead more productive lives. Hurry! Limited Time Offer: Get Up to 50% Off on Amazon's Best Sellers! Plasma is the key component in many lifesaving medicines. Talecris Plasma Resources Dallas welcomes you! We have a fun, experienced, knowledgeable, and friendly team that is dedicated to making your visit a pleasant one. We have an experienced, knowledgeable and friendly Also with the Grifols Plasma Promotions, you can now receive a generous $400 Grifols plasma first-time donor pay in your first four donations and a $150 referral bonus by inviting your friends to donate plasma. Grifols Talecris Plasma Resources welcomes you! Come visit us while you donate plasma that will be used to make life-changing medicines. Share with friends Grifols DonorHub™ is the convenient app designed to streamline your plasma donation journey. is located north of Mall 205 at the crossing of 102nd Ave and Stark St. Tuesday: 07:00 Biomat USA, Inc. What is CSL Plasma Donation? CSL Plasma is one of the leading plasma services provides in the world. Talecris Plasma Resources, Inc. General Tuesday, 21 January 2025. New Visual Design & Enhanced User Experience: Enjoy a fresh, intuitive interface that makes navigating the app a breeze. Monday: Closed. Two workers leave for lunch. 900 plasma donations are needed to treat 1 Alpha-1 patient 1200 plasma donations are required to treat 1 patient with Hemophilia CSL Plasma Coupon $5. Grifols Plasma $10 Coupons & Bonus [RECENTLY EXPIRED] Grifols Talecris Charlotte - Plasma Donation Centers, Charlotte. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Jacksonville, Florida at 2444 Mayport Rd, Jacksonville, FL 32233. Enjoy exclusive offers and discounts when you donate plasma at grifols. Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Dallas, Texas at 8057 W Virginia Dr, Dallas, TX 75237. Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Port Huron, Michigan at 649 24th St, Port Huron, MI 48060. Let's make this holiday season extra special! Unwrap the details: About Grifols Talecris - Plasma Donation Center. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 Buddy Bonus Program available Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Indianapolis, Indiana at 6340 Gateway Dr Suite 2, Indianapolis, IN 46254. Must Buddy bonus program; Specialty plasma programs; Frequently Asked Questions; About Grifols. Our goal is to make your experience a BioLife Plasma does not have any locations outside of the United States. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Moorhead, Minnesota at 800 Holiday Dr Ste 140, Moorhead, MN 56560. 4670 Cumberland Rd Fayetteville, NC 28306 Here's everything you need to know to donate at Talecris Plasma Resources in Louisville, Kentucky at 5037 Preston Hwy, Louisville, KY 40213. Location. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 Buddy Bonus Program available; Your payment Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Lakewood, Colorado at 145 S Sheridan Blvd Suite 200, Lakewood, CO 80226. Without two sets of plasma test results and health screenings, we can't use your plasma to make our lifesaving medicines. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Colorado Springs, Colorado at 2502 E Pikes Peak Ave Suite 180, Colorado Springs, CO 80909. You must successfully donate a second time within six months to become a plasma donor. Talecris pays new donors $50 on the first donation, $75 for the second donation, and $100 for the third donation. After all, it’s your donations that make our life Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Waukegan, Illinois at 2609 Grand Ave, Waukegan, IL 60085. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent Buddy Bonus Here's everything you need to know to donate at Talecris Plasma Resources, Inc. Grifols Talecris - Plasma Donation Center - Blood Donation Center. About Grifols Talecris - Plasma Donation Center. 1. Learn more about it from my Grifols Plasma Bonus Coupons post. CSL Plasma Returning Donors extra Bonus Payouts. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent Buddy Bonus Here's everything you need to know to donate at Grifols Talecris Plasma Resources in El Paso, Texas at 720 Texas Ave, El Paso, TX 79901. in St Paul, Minnesota at 1695 S Robert St, St Paul, MN 55118. Make a difference and earn Grifols Plasma Bonus Coupons. Tuesday: 06:00 AM - 07:00 PM. May not be combined with any other offer/coupon Expires 8-31-22. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Salem, Oregon at 351 Belmont St NE, Salem, OR 97301. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program available Also, check CSL Plasma coupons if you are interested. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program available; Your Talecris Plasma Resources, part of the Grifols Network of Plasma Donation Centers, is dedicated to donor safety and high-quality plasma. If you heard about us from a friend, tell us their name and we’ll reward them too! Claim Your New Donor Coupon. Learn more and find a donation center near you. you can earn this $75 bonus on the 8th donation of the month. Grifols Talecris - Plasma Donation Center located at 1025 N. Monday: 07:00 AM - 02:00 PM. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Must Buddy Bonus Program available Here's everything you need to know to donate at Talecris Plasma Resources in Anderson, Indiana at 3533 S Scatterfield Rd, Anderson, IN 46013. Hours. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Must Buddy Bonus Program available Grifols Talecris - Plasma Donation Center located at 2840 South Dort Highway, Flint, MI 48507 - reviews, ratings, hours, phone number, directions, and more. We collect protein-rich plasma to develop life-saving therapies for conditions like immune deficiencies, hemophilia, and hepatitis. Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Lansing, Michigan at 921 W Holmes Rd Suite 300, Lansing, MI 48910. Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Canton, Ohio at 824 30th St NW, Canton, OH 44709. must be 18-64 years old; Donors in Alabama and Nebraska must be at least 19 years old to donate at any location Claim Your New Donor Coupon Claim Your New Donor Bonus. Grifols Plasma Promotions offers up to a $400 New donor bonus in your first four donations. Let OPI be your go-to when searching to find a plasma center near you that pays well. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program available Refer A Friend Bonus $50* *Compensation amounts are subject to change. Make a difference and earn more with bliss coupon! Grifols plasma has united some of the best plasma donation centers in the industry under our grifols network, allowing you to donate plasma across the nation. Minnesota Avenue, Sioux Falls, SD 57104 - reviews, ratings, hours, phone number, directions, and more. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Monroe, Louisiana at 3511-A Desiard Street, Monroe, LA 71203. Sunday: 08:00 AM - 05:00 PM. ️ Don't miss out on your Perfect Match! ️ Remember, you can earn a bonus by donating this February and March. Donors are paid for their time, ensuring safety and comfort. Explore the Grifols Plasma Buddy Bonus Program a regrading way to give back together! Learn about the benefits, eligibility, and how you and your friends can make a positive impact on Grifols Plasma Bonus Coupons are promotions offered by Grifols Plasma Donation Centers to encourage people to donate plasma. . Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Portland, Oregon at 10115 SE Stark St, Portland, OR 97216. Make a difference and earn more with bliss coupon! Go to the official website and sign up here for promotion details. Monday: 08:00 AM - 06:30 PM. CSL Plasma has now a new offer as Returning Donors earn extra Bonus Payouts of an extra $75 when you donate. If you heard about us from a friend, tell us their name Check with us to see if you qualify for a special plasma collection program and special compensation rates. ONE WEEK left to qualify for our ""ONE MORE"" Bonus! ⏳! The clock is ticking! Don't miss this chance to double your impact and get paid for your generosity. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Buddy Bonus Program Donors at Grifols Talecris Plasma Resources, Inc. We collect protein-rich plasma to develop life-saving therapies for conditions like immune deficiencies, hemophilia, and hepatitis. You can earn $100 after their second successful donation. Time wasted: 1 hour Update 2: Sept 2021: walked in at 215pm, checked in. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Buddy Bonus Program Here's everything you need to know to donate at Talecris Plasma Resources in Toledo, Ohio at 625 Dorr St, Toledo, OH 43604. Your email address will not be used for any other purpose, and you About Grifols Talecris - Plasma Donation Center. Grifols Plasma New Donor Bonus, Grifols Plasma Pay Chart 2022, Grifols Plasma Payment Schedule 2022. You can get extra rewards for donating plasma regularly, such as gift cards, raffle entries, or bonus payments. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program available Here's everything you need to know to donate at Talecris Plasma Resources in San Antonio, Texas at 2118 S Zarzamora St #448, San Antonio, TX 78207. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program available About Grifols Talecris - Plasma Donation Center. Ready, Set, Shop! Get Up to 50% Off Amazon x Talecris Plasma Bonus Coupons Deals. So, please call your plasma donation center to make that important second donation. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Pensacola, Florida at 3810 Barrancas Ave Suite C, Pensacola, FL 32507. Same Login, No Hassle: No Donate 2x in the first week of the month. Donate ONE MORE TIME in August then your Earn additional bonuses when you refer your friends to donate plasma. So stay with us, In this article, we’ll navigate through the details of the Grifols Plasma Pay Chart, covering payment schedules, bonuses, and the potential to earn Here's everything you need to know to donate at Talecris Plasma Resources in Baton Rouge, Louisiana at 5906 Airline Hwy # 101, Baton Rouge, LA 70805. We are 2 blocks south of Burnside Max Station. In the 2 yrs that i been going i have had at least 3 complete blood losses Grab coupons at Talecris Plasma Bonus Coupons today. Sunday: 08:00 AM - 02:00 PM. Since our founding in 1909, our ever-growing mastery of plasma, diagnostics and life sciences, backed by our ethical leadership and industry-leading About Grifols Talecris - Plasma Donation Center. Limited time offer. Kedplasma Bonus 2024: Top 6 Birthday, Covid, Buddy, Referral. Find reviews, ratings, directions, business hours, and book appointments online. 4600 Bragg Blvd. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Buddy Bonus Program Refer A Friend Bonus $50* *Compensation amounts are subject to change. Sunday: 08:00 AM - 04:00 PM. Monday: 07:00 AM - 07:00 PM. Benefits & Balance The Benefits of Plasma as a Treatment for Autoimmune Disorders - Grifols Grifols Talecris - Plasma Donation Center - Blood Donation Center. It’s much more simple and straightforward, where donors are paid a fixed amount regardless of how much they weigh or the volume of plasma they donate. The exact amount depends on your weight, the location of the center, and the current demand for plasma. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Lake Charles, Louisiana at 1001 Gerstner Memorial Dr #14, Lake Charles, LA 70601. Fayetteville, NC 28303 910-867-9915 Learn More Learn More Grifols. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program available; Your Be Merry Bonus It's time to shine! Donate 6x in November for a $25 bonus. Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Roanoke, Virginia at 2727 Franklin Rd SW, Roanoke, VA 24014. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program available; Your payment • Rewarding ride: Get notified about bonus opportunities and special offers just for using the app! Ready to level up your donation game? Be the first to know and let us send you an email when Grifols Talecris Charlotte - Plasma Donation Centers posts news and promotions. Search Disappointed in the promotional offers saying that on your eight donation in June you get an extra 100 bonus. you start up 6 months later and get your new donor bonus. Monday: 07:00 AM - 07:30 PM. i be already Here's everything you need to know to donate at Talecris Plasma Resources in Harrisburg, Pennsylvania at 2933 N 7th St, Harrisburg, PA 17110. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Champaign, Illinois at 241 S Mattis Ave, Champaign, IL 61821. Monday: 08:00 AM - 03:00 PM. Hours of Operation: CSL Plasma and BioLife Plasma hours vary by location. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid Buddy Bonus Program Refer A Friend Bonus $50* *Compensation amounts are subject to change. CSL Plasma iGive Rewards Promo Code: Top 5 Working. Sunday: Closed. Tuesday: 07:00 AM - 07:30 PM. Biolife ATM: Locations, Near Me, Debit Card, Free. Refer A Friend Bonus $50* *Compensation amounts are subject to change. Learn Fill out the form below and we’ll send you an email so that you can claim your new donor bonus. Donate 4x, 5x, or 6x+ times in February and match it in March: Donate More, Earn More! Every donation makes a Refer A Friend Bonus $50* *Compensation amounts are subject to change. Grifols is one such healthcare service provider company that is dedicated to make treatment for life challenging conditions and chronic illness accessible by encouraging and facilitating plasma donations. If you’re planning on donating plasma at either Grifols, Biomat USA, or Talecris, you can expect the first-time donor bonus to pay about $100 per donation for the first four donations made within the first month. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program available; Your Refer A Friend Bonus $50* *Compensation amounts are subject to change. Receive $50 for all the friends you bring in this month that have not donated with our company before. , or Talecris Plasma Resources, Inc. And that means your first donation has to be discarded. At the time To get a grifols plasma bonus coupon: Enjoy exclusive offers and discounts when you donate plasma at grifols. Cancel. stating a 100 1× bonus on top of regular pay. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Buddy Bonus Program Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Yuma, Arizona at 1881 S 4th Ave Ste. If you tried to get someone a referral bonus for you returning, even though you get the new donor bonus you're not really a Save and improve lives by becoming a Grifols plasma donor. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent Buddy Bonus Program In addition to getting paid for your time, you can also make even more money by taking advantage of our plasma referral bonus and special plasma donation promotions throughout the year. Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Rockford, Illinois at 1052 W Riverside Blvd Ste 132, Rockford, IL 61103. Talecris Plasma Resources in Yuma welcomes you! Come visit us and our friendly team while you donate plasma that will be used to make life-changing medicines! Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Little Rock, Arkansas at 6227 Colonel Glenn Rd, Little Rock, AR 72204. , PlasmaCare, Inc. View Sale. See Details. Sunday: 07:00 AM - 03:00 PM. Grifols Talecris - Plasma Donation Center located at 2933 North 7th Street, Harrisburg, PA 17110 - reviews, ratings, hours, phone number, directions, and more. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address Must Buddy Bonus Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Amarillo, Texas at 1709-1729 S Avondale St, Amarillo, TX 79106. Grifols Plasma Promotions: $400 Bonus. The specific amount you receive will depend on factors like your weight, the donation center’s Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Pueblo, Colorado at 1501 Moore Ave, Pueblo, CO 81005. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Buddy Bonus Program Talecris Plasma Receive a $40 Bonus on your first successful donation when scheduled on a Tuesday or Thursday between 9am-4pm. Let's make this holiday season extra special! Unwrap the details: Here's everything you need to know to donate at Grifols Talecris Plasma Resources in Shreveport, Louisiana at 1020 Shreveport Barksdale Hwy Ste 160, Shreveport, LA 71105. As a Grifols plasma donor, your comfort and safety are our number one priority. Next, let’s cover how Biomat USA and Talecris Plasma Resources pay their donors. All qualified donors must meet these Read 400 customer reviews of Talecris Plasma Resources, one of the best Blood & Plasma Donation Centers businesses at 921 West Holmes Road, Suite 300, Lansing, MI 48910 United States. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Valid ID Permanent address. Grifols provides an average payment of $50 to $75 for each plasma donation, with a special offer of up to $125 for first-time donors. All qualified donors must meet these requirements: Ages 18-69 Weighs over 110 pounds No Tattoos, piercings or permanent makeup within the last 4 months Buddy Bonus Program available You donate plasma for a few months and then stop. Talecris Plasma Resources, part of the Grifols Network of Plasma Donation Centers, is dedicated to donor safety and high-quality plasma. Let us know how you heard about us. No need for a coupon code. (34) We collect protein-rich plasma to develop life-saving therapies for conditions like immune deficiencies, hemophilia, and hepatitis. Donors are paid for their time, ensuring safety and comfort. These coupons provide additional rewards for donors who receive regular income for donating plasma. Be Merry Bonus It's time to shine! Donate 6x in November for a $25 bonus. Talecris Plasma New Donor Discount Codes 14 Discount Codes Updated on 01/20/2025 Talecris Plasma New Donor Coupons and Promo Codes for January 2025. o S e s d r p o n t i m a 0 m 8 L g 1 6 5 5 m r 8 1 u 7 h 8 a t 0 m a 4 6 4 e 6 e 0 t 6 l 2 r 9 0 m l o 0 n m 8 2 3 l Find great Talecris Plasma New Donor promo codes and discounts at CouponAnnie today. This makes a total of $225 in just three donations for new donors. Become a Plasma Donor Here's everything you need to know to donate at Grifols Talecris Plasma Donation Center in Glendale, Arizona at 5048 W Northern Ave #101, Glendale, AZ 85301. Check with us to see if you qualify for a special plasma collection program and special compensation rates. Tuesday: 07:00 AM PlasmaCare, Inc. Search I had had $40 bonus coupon that I then could not use. Tuesday: 07:00 AM - 06:00 PM. Tuesday: 08:00 AM - 07:00 PM. rzdzyvevndhflqsmnvvidilmytpmmimwaibggmokxuafbvewlmkcgiecudgpyghgdtiskvfosomjnkc